GATA2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB573929
- Bilder (7)
| Artikelname: | GATA2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB573929 |
| Hersteller Artikelnummer: | orb573929 |
| Alternativnummer: | BYT-ORB573929-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human GATA2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DCML, IMD21, NFE1B, MONOMAC |
| Rabbit polyclonal antibody to GATA2 |
| Klonalität: | Polyclonal |
| Konzentration: | 1.0 mg/ml |
| Molekulargewicht: | 51 kDa |
| NCBI: | 116027 |
| UniProt: | P23769 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA |
| Target-Kategorie: | GATA2 |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Positive control (+): Hela (HL), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml. |
|
|
Human Liver |
|
|
Lane 1: 30 ug mouse liver lysate, Lane 2: 30 ug mouse N2a cell lysate, Primary Antibody dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:2500, Gene Name: GATA2. |
|
|
WB Suggested Anti-GATA2 antibody Titration: 1 ug/ml, Sample Type: Human K562. |
|
|
WB Suggested Anti-GATA2 Antibody Titration: 1.0-2.0 ug/ml, ELISA Titer: 1:1562500, Positive Control: K562 cell lysate, GATA2 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells. |
Produktgarantie und fachkundiger Support
