CLDN1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574761
- Bilder (7)
| Artikelname: | CLDN1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB574761 |
| Hersteller Artikelnummer: | orb574761 |
| Alternativnummer: | BYT-ORB574761-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CLD1, SEMP1, ILVASC |
| Rabbit polyclonal antibody to Claudin 1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 23 kDa |
| NCBI: | 066924 |
| UniProt: | O95832 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV |
| Target-Kategorie: | CLDN1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Human Liver |
|
|
WB Suggested Anti-CLDN1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
