CREB3L2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB575199
- Bilder (7)
| Artikelname: | CREB3L2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB575199 |
| Hersteller Artikelnummer: | orb575199 |
| Alternativnummer: | BYT-ORB575199-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human CREB3L2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BBF2H7 |
| Rabbit polyclonal antibody to CREB3L2 |
| Klonalität: | Polyclonal |
| Konzentration: | 1.0 mg/ml |
| Molekulargewicht: | 57 kDa |
| NCBI: | 919047 |
| UniProt: | Q70SY1 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: HSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDF |
| Target-Kategorie: | CREB3L2 |
|
|
25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 51 kDa. |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml. |
|
|
Human kidney |
|
|
WB Suggested Anti-CREB3L2 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:12500, Positive Control: Jurkat cell lysate. |
Produktgarantie und fachkundiger Support
