ANXA1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB576008
- Bilder (7)
| Artikelname: | ANXA1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB576008 |
| Hersteller Artikelnummer: | orb576008 |
| Alternativnummer: | BYT-ORB576008-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ANX1, LPC1 |
| Rabbit polyclonal antibody to ANXA1 |
| Klonalität: | Polyclonal |
| Konzentration: | 1.0 mg/ml |
| Molekulargewicht: | 39 kDa |
| NCBI: | 000691 |
| UniProt: | P04083 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD |
| Target-Kategorie: | ANXA1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. |
|
|
Sample Tissue: Human ACHN, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. |
|
|
Positive control (+): A549 (N03), Negative control (-): RPMI-8226 (N12), Antibody concentration: 0.5 ug/ml. |
|
|
Human Intestine |
|
|
WB Suggested Anti-ANXA1 Antibody, Positive Control: Lane 1: 20 ug mouse fibroblast lysates, Primary Antibody Dilution: 1:600, Secondary Antibody: Anti rabbit-HRP, Secondry Antibody Dilution: 1:2000. |
|
|
WB Suggested Anti-ANXA1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
