NOTCH1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB577050
- Bilder (7)
| Artikelname: | NOTCH1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB577050 |
| Hersteller Artikelnummer: | orb577050 |
| Alternativnummer: | BYT-ORB577050-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human NOTCH1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | hN1, AOS5, TAN1, AOVD1 |
| Rabbit polyclonal antibody to NOTCH1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 273 kDa |
| NCBI: | 060087 |
| UniProt: | P46531 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: EHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK |
| Target-Kategorie: | NOTCH1 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Full length NOTCH1 (~273 kDa) is not shown in this experiment, cleavage products of NOTCH1 are detected including the NOTCH Intracellular Domain at 88 kDa. |
|
|
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Rabbit Anti-NOTCH1 Antibody, Catalog Number: orb577050, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec. |
|
|
WB Suggested Anti-NOTCH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. |
Produktgarantie und fachkundiger Support
