Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: EHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
Target-Kategorie:
NOTCH1
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Full length NOTCH1 (~273 kDa) is not shown in this experiment, cleavage products of NOTCH1 are detected including the NOTCH Intracellular Domain at 88 kDa.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human U937 Whole Cell, Antibody Dilution: 1 ug/ml.
Rabbit Anti-NOTCH1 Antibody, Catalog Number: orb577050, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.