NONO Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB577744
- Bilder (7)
| Artikelname: | NONO Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB577744 |
| Hersteller Artikelnummer: | orb577744 |
| Alternativnummer: | BYT-ORB577744-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human NONO |
| Konjugation: | Unconjugated |
| Alternative Synonym: | P54, NMT55, NRB54, MRXS34, P54NRB, PPP1R114 |
| Rabbit polyclonal antibody to NONO |
| Klonalität: | Polyclonal |
| Konzentration: | 1.0 mg/ml |
| Molekulargewicht: | 52kDa |
| NCBI: | 031389 |
| UniProt: | Q15233 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
| Target-Kategorie: | NONO |
|
|
Human kidney |
|
|
Human Liver |
|
|
NONO was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb577744 with 1:200 dilution. Western blot was performed using orb577744 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: NONO IP with orb577744 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate. |
|
|
Rabbit Anti-NONO Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Rabbit Anti-NONO Antibody, Paraffin Embedded Tissue: Human cardiac cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Sample Type: subnuclear bodies-paraspeckles. |
|
|
WB Suggested Anti-NONO Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
