PUF60 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB577765
- Bilder (7)
| Artikelname: | PUF60 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB577765 |
| Hersteller Artikelnummer: | orb577765 |
| Alternativnummer: | BYT-ORB577765-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human PUF60 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FIR, VRJS, RoBPI, SIAHBP1 |
| Rabbit polyclonal antibody to PUF60 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 58kDa |
| NCBI: | 055096 |
| UniProt: | Q9UHX1 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA |
| Target-Kategorie: | PUF60 |
|
|
orb577765 |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml. |
|
|
Rabbit Anti-PUF60 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec. |
|
|
Rabbit Anti-PUF60 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
WB Suggested Anti-PUF60 Antibody Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate. PUF60 is supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
WB Suggested Anti-PUF60 Antibody Titration: 0.5 ug/ml Positive Control: Human 293T cell lysate. |
Produktgarantie und fachkundiger Support
