MSI2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB577913
- Bilder (7)
| Artikelname: | MSI2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB577913 |
| Hersteller Artikelnummer: | orb577913 |
| Alternativnummer: | BYT-ORB577913-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the N terminal region of human MSI2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MSI2H |
| Rabbit polyclonal antibody to MSI2 |
| Klonalität: | Polyclonal |
| Konzentration: | 1.0 mg/ml |
| Molekulargewicht: | 35 kDa |
| NCBI: | 620412 |
| UniProt: | Q96DH6 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL |
| Target-Kategorie: | MSI2 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. |
|
|
Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. |
|
|
Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 2 ug/ml. |
|
|
MSI2 antibody - N-terminal region (orb577913) validated by WB using K562 cells lysate at 1:1000. |
|
|
Rabbit Anti-MSI2 Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Rabbit Anti-MSI2 Antibody, Paraffin Embedded Tissue: Human Liver, Cellular Data: Hepatocytes, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
WB Suggested Anti-MSI2 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. |
Produktgarantie und fachkundiger Support
