PANX1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB578598
- Bilder (7)
| Artikelname: | PANX1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB578598 |
| Hersteller Artikelnummer: | orb578598 |
| Alternativnummer: | BYT-ORB578598-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human PANX1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PX1, MRS1, OOMD7, UNQ2529 |
| Rabbit polyclonal antibody to PANX1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 47kDa |
| NCBI: | 056183 |
| UniProt: | Q96RD7 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN |
| Target-Kategorie: | PANX1 |
|
|
Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/ml. |
|
|
Sample Type: Hela whole cell lysates, Antibody Dilution: 1.0 ug/ml. PANX1 is supported by BioGPS gene expression data to be expressed in HeLa. |
|
|
Human Intestine |
|
|
Sample Type: Human Jurkat cell lysate, Antibody Dilution: 1.0 ug/ml. |
|
|
Rabbit Anti-PANX1 Antibody, Paraffin Embedded Tissue: Human neural cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X. |
|
|
Sample Type: Mouse Retina and Knockout PANX-1 Mouse Tissue. |
|
|
WB Suggested Anti-PANX1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. |
Produktgarantie und fachkundiger Support
