SHH Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB579101
Artikelname: SHH Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB579101
Hersteller Artikelnummer: orb579101
Alternativnummer: BYT-ORB579101-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Gallus, Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHH
Konjugation: Unconjugated
Alternative Synonym: TPT, HHG1, HLP3, HPE3, SMMCI, ShhNC, TPTPS, MCOPCB5
Rabbit polyclonal antibody to SHH
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 28 kDa
NCBI: 000184
UniProt: Q15465
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
Target-Kategorie: SHH
Chicken embryos, Primary antibody: 1:1000 (orb579101) anti-shh Secondary Antibody: 1:500 (ASP00001) goat anti-rabbit HRP conjugated.
Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Stomach Tumor, Antibody Dilution: 1.0 ug/ml.
Rabbit Anti-SHH Antibody, Catalog Number: orb579101, Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue, Observed Staining: Plasma membrane, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Sample Type: Human glioma cells, Primary Antibody Dilution: 1:200, Secondary Antibody: Anti-rabbit-GFP, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: 1. SHH: Green 2. DAPI: Blue 3. Merge, Gene Name: SHH.
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-SHH Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.