GP2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB579212
- Bilder (7)
| Artikelname: | GP2 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB579212 |
| Hersteller Artikelnummer: | orb579212 |
| Alternativnummer: | BYT-ORB579212-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human GP2 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ZAP75 |
| Rabbit polyclonal antibody to GP2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 59 kDa |
| NCBI: | 001007242 |
| UniProt: | P55259 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES |
| Target-Kategorie: | GP2 |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment. The canonical isoform of 59 kDa is present as well as a second isoform around 43 kDa. |
|
|
Anti-GP2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
|
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml. |
|
|
Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GP2 is expressed in HepG2. |
|
|
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml. |
|
|
Positive control (+): Human Fetal Heart (HE), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml. |
|
|
WB Suggested Anti-GP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart. |
Produktgarantie und fachkundiger Support
