Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
Target-Kategorie:
GP2
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 4 ug/ml of the antibody was used in this experiment. The canonical isoform of 59 kDa is present as well as a second isoform around 43 kDa.
Anti-GP2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
Sample Tissue: Human HCT116 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that GP2 is expressed in HepG2.
Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Positive control (+): Human Fetal Heart (HE), Negative control (-): Human Brain (BR), Antibody concentration: 1 ug/ml.