Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz:
Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
Target-Kategorie:
HSD11B1
Sample Tissue: Rodent Rat Testis, Antibody dilution: 2 ug/ml.
Positive control (+): Human Placenta (PL), Negative control (-): Human cerebral cortex, Antibody concentration: 1 ug/ml.
Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.
Immunohistochemistry with Human Liver cell lysate tissue at an antibody concentration of 5.0 ug/ml using anti-HSD11B1 antibody (orb579552).
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 0.5, 5, and 50 ug/ml. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for either two or three concentrations were averaged and results and standard deviation are shown.
