ABCB1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB581349
- Bilder (7)
| Artikelname: | ABCB1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB581349 |
| Hersteller Artikelnummer: | orb581349 |
| Alternativnummer: | BYT-ORB581349-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human ABCB1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CLCS, MDR1, P-GP, PGY1, ABC20, CD243, GP170, p-170 |
| Rabbit polyclonal antibody to MDR1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 141kDa |
| NCBI: | 000918 |
| UniProt: | P08183 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ |
| Target-Kategorie: | ABCB1 |
|
|
Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human K562 Whole Cell, Antibody dilution: 5 ug/ml. |
|
|
Sample Tissue: Human Lung Tumor, Antibody dilution: 1 ug/ml. |
|
|
Positive control (+): Rat Liver (R-LI), Negative control (-): Rat Testis (R-TE), Antibody concentration: 1 ug/ml. |
|
|
Immunohistochemistry with Human Adrenal tissue. |
|
|
Immunohistochemistry with Human Placenta tissue. |
|
|
WB Suggested Anti-ABCB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: NCI-H226 cell lysate. |
Produktgarantie und fachkundiger Support
