PDIA6 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB581571
- Bilder (7)
| Artikelname: | PDIA6 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB581571 |
| Hersteller Artikelnummer: | orb581571 |
| Alternativnummer: | BYT-ORB581571-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human PDIA6 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | P5, ERP5, TXNDC7 |
| Rabbit polyclonal antibody to PDIA6 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 48kDa |
| NCBI: | 005733 |
| UniProt: | Q15084 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA |
| Target-Kategorie: | PDIA6 |
|
|
Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells. |
|
|
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Type: MCF7, Antibody dilution: 1.0 ug/ml. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in MCF7. |
|
|
Immunohistochemistry with Small intestine tissue. |
|
|
WB Suggested Anti-PDIA6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate. PDIA6 is strongly supported by BioGPS gene expression data to be expressed in HepG2. |
Produktgarantie und fachkundiger Support
