BMPER Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB581757
- Bilder (7)
| Artikelname: | BMPER Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB581757 |
| Hersteller Artikelnummer: | orb581757 |
| Alternativnummer: | BYT-ORB581757-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the C terminal region of human BMPER |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CV2, CV-2, CRIM3 |
| Rabbit polyclonal antibody to BMPER |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 76 kDa |
| NCBI: | 597725 |
| UniProt: | Q8N8U9 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV |
| Target-Kategorie: | BMPER |
|
|
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment. |
|
|
BMPER was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb581757 with 1:200 dilution. Western blot was performed using orb581757 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: BMPER IP with orb581757 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate. |
|
|
Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml. |
|
|
Human Lung |
|
|
Human Lung |
|
|
Immunohistochemistry with Human Lung, respiratory epethelium tissue at an antibody concentration of 5.0 ug/ml using anti-BMPER antibody (orb581757). |
|
|
WB Suggested Anti-BMPER Antibody Titration: 1 ug/ml, Positive Control: Fetal heart lysate. |
Produktgarantie und fachkundiger Support
