GNAI1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB582414
- Bilder (7)
| Artikelname: | GNAI1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB582414 |
| Hersteller Artikelnummer: | orb582414 |
| Alternativnummer: | BYT-ORB582414-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human GNAI1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Gi |
| Rabbit polyclonal antibody to GNAI1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 40kDa |
| NCBI: | 002060 |
| UniProt: | P63096 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH |
| Target-Kategorie: | GNAI1 |
|
|
Sample Type: Nthy-ori cell lysate (50 ug), Primary dilution: 1:1000, Secondary Antibody: anti-rabbit HRP, Secondary dilution: 1:2000. |
|
|
Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml. |
|
|
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml. |
|
|
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml. |
|
|
WB Suggested Anti-GNAI1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human brain. |
Produktgarantie und fachkundiger Support
