Human IL36G protein

Artikelnummer: BYT-ORB594810
Artikelname: Human IL36G protein
Artikelnummer: BYT-ORB594810
Hersteller Artikelnummer: orb594810
Alternativnummer: BYT-ORB594810-10,BYT-ORB594810-50,BYT-ORB594810-500,BYT-ORB594810-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-36 gamma, IL36G, IL-1-related protein 2, IL-1RP2, IL-1 epsilon, IL-1F9, Interleukin-1 homolog 1, IL-1H1
This Human IL36G protein spans the amino acid sequence from region 18-169aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 17 kDa
UniProt: Q9NZH8
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM EDTA, pH 8.0
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by its ability to induce IL-8 secretion in A431 human epithelial carcinoma cells is 5-20 ng/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.