Mouse IL13 protein

Artikelnummer: BYT-ORB594830
Artikelname: Mouse IL13 protein
Artikelnummer: BYT-ORB594830
Hersteller Artikelnummer: orb594830
Alternativnummer: BYT-ORB594830-10,BYT-ORB594830-50,BYT-ORB594830-500,BYT-ORB594830-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-13, IL-13, T-Cell Activation Protein P600, Il13, Il-13
This Mouse IL13 protein spans the amino acid sequence from region 26-131aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 12.7 kDa
UniProt: P20109
Puffer: Lyophilized from a 0.2 µm filtered 1xPBS, pH 7.4
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is 2-13 ng/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.