Mouse Il17a protein

Artikelnummer: BYT-ORB594832
Artikelname: Mouse Il17a protein
Artikelnummer: BYT-ORB594832
Hersteller Artikelnummer: orb594832
Alternativnummer: BYT-ORB594832-10,BYT-ORB594832-50,BYT-ORB594832-500,BYT-ORB594832-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-17A, IL-17, IL-17A, Cytotoxic T-Lymphocyte-Associated Antigen 8, CTLA-8, IL17A, CTLA8, IL17
This Mouse Il17a protein spans the amino acid sequence from region 22-158aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 16.2 kDa
UniProt: Q62386
Puffer: Lyophilized from a 0.2 µm filtered solution of PBS,PH7.4.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined by its ability to induce IL-6 secretion by NIH-3T3 mouse embryonic fibroblast cells is 0.25-1.25 ng/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.