Mouse IL4 protein

Artikelnummer: BYT-ORB594835
Artikelname: Mouse IL4 protein
Artikelnummer: BYT-ORB594835
Hersteller Artikelnummer: orb594835
Alternativnummer: BYT-ORB594835-10,BYT-ORB594835-50,BYT-ORB594835-500,BYT-ORB594835-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Interleukin-4,B-cell IgG differentiation factor,B-cell growth factor 1,B-cell stimulatory factor 1,IGG1 induction factor,Lymphocyte stimulatory factor 1,IL-4,BSF-1
This Mouse IL4 protein spans the amino acid sequence from region 23-140aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 13.4 kDa
UniProt: P07750
Puffer: Lyophilized from a 0.2 µm filtered solution of 20mM PB, 300mM NaCl, 5% Trehalose, pH 6.5.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cell proliferation assay using M-NFS-60 mouse lymphoblast cells is 0.01 ng/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL