Human TNF protein

Artikelnummer: BYT-ORB594842
Artikelname: Human TNF protein
Artikelnummer: BYT-ORB594842
Hersteller Artikelnummer: orb594842
Alternativnummer: BYT-ORB594842-10,BYT-ORB594842-50,BYT-ORB594842-500,BYT-ORB594842-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Tumor Necrosis Factor, Cachectin, TNF-Alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, TNF, TNFA, TNFSF2
This Human TNF protein spans the amino acid sequence from region 57-233aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 21.8 kDa
UniProt: P01375
Puffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 100 mM NaCl, pH 7.2
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 30-150 pg/ml. Application Notes: Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL