Human LTA protein

Artikelnummer: BYT-ORB594848
Artikelname: Human LTA protein
Artikelnummer: BYT-ORB594848
Hersteller Artikelnummer: orb594848
Alternativnummer: BYT-ORB594848-10,BYT-ORB594848-50,BYT-ORB594848-500,BYT-ORB594848-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Lymphotoxin-Alpha, LT-Alpha, TNF-Beta, Tumor Necrosis Factor Ligand Superfamily Member 1, LTA, TNFB, TNFSF1
This Human LTA protein spans the amino acid sequence from region 35-205aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 18.8 kDa
UniProt: P01374
Puffer: Lyophilized from a 0.2 µm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 20-80 pg/ml. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.