Mouse Tnf protein

Artikelnummer: BYT-ORB594857
Artikelname: Mouse Tnf protein
Artikelnummer: BYT-ORB594857
Hersteller Artikelnummer: orb594857
Alternativnummer: BYT-ORB594857-10,BYT-ORB594857-50,BYT-ORB594857-500,BYT-ORB594857-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Tumor Necrosis Factor, Cachectin, TNF-Alpha, Tumor Necrosis Factor Ligand Superfamily Member 2, TNF-a, Tumor Necrosis Factor, Membrane Form, Tumor Necrosis Factor, Soluble Form, Tnf, Tnfa, Tnfsf2
This Mouse Tnf protein spans the amino acid sequence from region 89-235aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 16.4 kDa
UniProt: P06804
Puffer: Lyophilized from a 0.2 µm filtered 1xPBS, pH 7.4
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 2-8 pg/ml. Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.




* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL