Human PSMD14 protein

Artikelnummer: BYT-ORB595011
Artikelname: Human PSMD14 protein
Artikelnummer: BYT-ORB595011
Hersteller Artikelnummer: orb595011
Alternativnummer: BYT-ORB595011-20,BYT-ORB595011-100,BYT-ORB595011-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: 26S proteasome regulatory subunit RPN11 (26S proteasome-associated PAD1 homolog 1) (POH1)
This Human PSMD14 protein spans the amino acid sequence from region 1-310aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 79.2 kDa
UniProt: O00487
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNY
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) PSMD14.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Homo sapiens (Human) PSMD14.