Virus DBP protein

Artikelnummer: BYT-ORB595070
Artikelname: Virus DBP protein
Artikelnummer: BYT-ORB595070
Hersteller Artikelnummer: orb595070
Alternativnummer: BYT-ORB595070-20,BYT-ORB595070-100,BYT-ORB595070-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Early 2A protein (Early E2A DNA-binding protein) (DBP)
This Virus DBP protein spans the amino acid sequence from region 174-529aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 42.3 kDa
UniProt: P03265
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SVPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSKKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDA
Anwendungsbeschreibung: Biological Origin: Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5). Application Notes: Partial
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.
Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Baculovirus-expressed Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5) DBP.