Mouse Pld3 protein

Artikelnummer: BYT-ORB595175
Artikelname: Mouse Pld3 protein
Artikelnummer: BYT-ORB595175
Hersteller Artikelnummer: orb595175
Alternativnummer: BYT-ORB595175-20,BYT-ORB595175-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Choline phosphatase 3 (Phosphatidylcholine-hydrolyzing phospholipase D3) (Schwannoma-associated protein 9) (SAM-9) (Sam9) (PLD 3)
This Mouse Pld3 protein spans the amino acid sequence from region 1-488aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 58.2 kDa
UniProt: O35405
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQA
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Recombinant Mouse Phospholipase D3 (Pld3) Pld3.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Recombinant Mouse Phospholipase D3 (Pld3) Pld3.