Mouse Bcat1 protein

Artikelnummer: BYT-ORB603929
Artikelname: Mouse Bcat1 protein
Artikelnummer: BYT-ORB603929
Hersteller Artikelnummer: orb603929
Alternativnummer: BYT-ORB603929-20,BYT-ORB603929-100,BYT-ORB603929-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Protein ECA39 (BCAT(c)) (Eca39)
This Mouse Bcat1 protein spans the amino acid sequence from region 1-386aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 46.4 kDa
UniProt: P24288
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MKDCSNGCSAPFAGERGSEEVAETFRAKDLIITPATVLKEKPDPDSLVFGATFTDHMLTVEWSSASGWEKPHIKPFGNLPIHPAASVLHYAVELFEGLKAFRGVDNKIRLFRPDLNMDRMCRSAVRTTLPMFDKEELLKCILQLLQIDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPSKALLFVILSPVGPYFSSGSFTPVSLWANPKYIRAWKGGTGDCKMGGNYGASLLAQCEAVENGCQQVLWLYGKDNQI
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bcat1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Bcat1.