Human CBS protein

Artikelnummer: BYT-ORB603958
Artikelname: Human CBS protein
Artikelnummer: BYT-ORB603958
Hersteller Artikelnummer: orb603958
Alternativnummer: BYT-ORB603958-20,BYT-ORB603958-100,BYT-ORB603958-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Beta-thionase, Serine sulfhydrase
This Human CBS protein spans the amino acid sequence from region 1-413aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 61.4 kDa
UniProt: P35520
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.