Human HBG2 protein

Artikelnummer: BYT-ORB604153
Artikelname: Human HBG2 protein
Artikelnummer: BYT-ORB604153
Hersteller Artikelnummer: orb604153
Alternativnummer: BYT-ORB604153-1,BYT-ORB604153-100,BYT-ORB604153-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Gamma-2-globin (Hb F Ggamma) (Hemoglobin gamma-2 chain) (Hemoglobin gamma-G chain)
This Human HBG2 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 23.0 kDa
UniProt: P69892
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HBG2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HBG2.