Human IL6 protein

Artikelnummer: BYT-ORB604194
Artikelname: Human IL6 protein
Artikelnummer: BYT-ORB604194
Hersteller Artikelnummer: orb604194
Alternativnummer: BYT-ORB604194-1,BYT-ORB604194-100,BYT-ORB604194-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: B-cell stimulatory factor 2 , BSF-2, CTL differentiation factor , CDFHybridoma growth factorInterferon beta-2 , IFN-beta-2
This Human IL6 protein spans the amino acid sequence from region 30-212aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 28.3 kDa
UniProt: P05231
Puffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 0.1518 - 0.3987 ng/mL. Application Notes: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 0.1518 - 0.3987 ng/mL.



* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL