Human NRL protein

Artikelnummer: BYT-ORB604287
Artikelname: Human NRL protein
Artikelnummer: BYT-ORB604287
Hersteller Artikelnummer: orb604287
Alternativnummer: BYT-ORB604287-1,BYT-ORB604287-100,BYT-ORB604287-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: NRL (D14S46E)
This Human NRL protein spans the amino acid sequence from region 1-237aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 33.4 kDa
UniProt: P54845
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NRL.