Mouse Pglyrp1 protein

Artikelnummer: BYT-ORB604307
Artikelname: Mouse Pglyrp1 protein
Artikelnummer: BYT-ORB604307
Hersteller Artikelnummer: orb604307
Alternativnummer: BYT-ORB604307-1,BYT-ORB604307-100,BYT-ORB604307-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cytokine tag7 (Peptidoglycan recognition protein short) (PGRP-S) (Pglyrp) (Pgrp) (Pgrps) (Tag7)
This Mouse Pglyrp1 protein spans the amino acid sequence from region 19-182aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 26.2 kDa
UniProt: O88593
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: FIVPRSEWRALPSECSSRLGHPVRYVVISHTAGSFCNSPDSCEQQARNVQHYHKNELGWCDVAYNFLIGEDGHVYEGRGWNIKGDHTGPIWNPMSIGITFMGNFMDRVPAKRALRAALNLLECGVSRGFLRSNYEVKGHRDVQSTLSPGDQLYQVIQSWEHYRE
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pglyrp1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pglyrp1.