Mouse Pmaip1 protein

Artikelnummer: BYT-ORB604317
Artikelname: Mouse Pmaip1 protein
Artikelnummer: BYT-ORB604317
Hersteller Artikelnummer: orb604317
Alternativnummer: BYT-ORB604317-1,BYT-ORB604317-100,BYT-ORB604317-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Protein Noxa (Noxa)
This Mouse Pmaip1 protein spans the amino acid sequence from region 1-103aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 15.6 kDa
UniProt: Q9JM54
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pmaip1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pmaip1.