Fish Oncorhynchus keta L-rhamnose-binding lectin CSL3 protein

Artikelnummer: BYT-ORB604534
Artikelname: Fish Oncorhynchus keta L-rhamnose-binding lectin CSL3 protein
Artikelnummer: BYT-ORB604534
Hersteller Artikelnummer: orb604534
Alternativnummer: BYT-ORB604534-1,BYT-ORB604534-100,BYT-ORB604534-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: L-rhamnose-binding lectin CSL3
This Fish Oncorhynchus keta L-rhamnose-binding lectin CSL3 protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 27 kDa
UniProt: P86179
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Oncorhynchus keta (Chum salmon) (Salmo keta)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD
Anwendungsbeschreibung: Biological Origin: Oncorhynchus keta (Chum salmon) (Salmo keta). Application Notes: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Oncorhynchus keta (Chum salmon) (Salmo keta).