Bacteria pscF protein

Artikelnummer: BYT-ORB604538
Artikelname: Bacteria pscF protein
Artikelnummer: BYT-ORB604538
Hersteller Artikelnummer: orb604538
Alternativnummer: BYT-ORB604538-1,BYT-ORB604538-100,BYT-ORB604538-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Pseudomonas secretion protein F
This Bacteria pscF protein spans the amino acid sequence from region 2-85aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 16.6 kDa
UniProt: P95434
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI
Anwendungsbeschreibung: Biological Origin: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) pscF.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) pscF.