E. coli traY protein

Artikelnummer: BYT-ORB604567
Artikelname: E. coli traY protein
Artikelnummer: BYT-ORB604567
Hersteller Artikelnummer: orb604567
Alternativnummer: BYT-ORB604567-1,BYT-ORB604567-100,BYT-ORB604567-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: traY, Relaxosome protein TraY
This E. coli traY protein spans the amino acid sequence from region 1-75aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 24.4 kDa
UniProt: P10512
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MRRRNARGGISRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVIEENESTFKEL
Anwendungsbeschreibung: Biological Origin: Escherichia coli. Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colitraY.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia colitraY.