Bacteria bla protein

Artikelnummer: BYT-ORB604739
Artikelname: Bacteria bla protein
Artikelnummer: BYT-ORB604739
Hersteller Artikelnummer: orb604739
Alternativnummer: BYT-ORB604739-1,BYT-ORB604739-100,BYT-ORB604739-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: shv5
This Bacteria bla protein spans the amino acid sequence from region 22-286aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 36.3 kDa
UniProt: P0A3M1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Klebsiella pneumoniae
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGASKRGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGI
Anwendungsbeschreibung: Biological Origin: Klebsiella pneumoniae. Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniaebla.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniaebla.