E. coli bamA protein

Artikelnummer: BYT-ORB604796
Artikelname: E. coli bamA protein
Artikelnummer: BYT-ORB604796
Hersteller Artikelnummer: orb604796
Alternativnummer: BYT-ORB604796-1,BYT-ORB604796-100,BYT-ORB604796-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Omp85 (yaeT) (yzzN) (yzzY)
This E. coli bamA protein spans the amino acid sequence from region 175-424aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 36.0 kDa
UniProt: P0A940
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTG
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: Partial
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) bamA.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) bamA.