Animal Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein

Artikelnummer: BYT-ORB604851
Artikelname: Animal Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein
Artikelnummer: BYT-ORB604851
Hersteller Artikelnummer: orb604851
Alternativnummer: BYT-ORB604851-1,BYT-ORB604851-100,BYT-ORB604851-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Fetidin (Hemolysin) (Lysenin-3) (efL3) (LRP-2)
This Animal Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin protein spans the amino acid sequence from region 1-300aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 41.6 kDa
UniProt: O18425
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Eisenia fetida (Red wiggler worm)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MSSRAGIAEGYEQIEVDVVAVWKEGYVYENRGSTSVEQKIKITKGMRNLNSETKTLTASHSIGSTISTGDLFEIATVDVSYSYSHEESQVSMTETEVYESKEIEHTITIPPTSKFTRWQLNADVGGADIEYMYLIDEVTPIGGTLSIPQVIKSRAKILVGREIYLGETEIRIKHADRKEYMTVVSRKSWPAATLGHSKLYKFVLYEDMYGFRIKTLNTMYSGYEYAYSSDQGGIYFDQGSDNPKQRWAINKSLPL
Anwendungsbeschreibung: Biological Origin: Eisenia fetida (Red wiggler worm). Application Notes: Full Length
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Eisenia fetida (Red wiggler worm).
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Eisenia fetida (Red wiggler worm).