Bovine PAG2 protein

Artikelnummer: BYT-ORB604922
Artikelname: Bovine PAG2 protein
Artikelnummer: BYT-ORB604922
Hersteller Artikelnummer: orb604922
Alternativnummer: BYT-ORB604922-1,BYT-ORB604922-100,BYT-ORB604922-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: PAG 2
This Bovine PAG2 protein spans the amino acid sequence from region 22-376aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 43.6 kDa
UniProt: Q28057
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Bos taurus (Bovine)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: KKMKTLRETLREKNLLNNFLEEQAYRLSKNDSKITIHPLRNYLDTAYVGNITIGTPPQEFRVVFDTGSANLWVPCITCTSPACYTHKTFNPQNSSSFREVGSPITIFYGSGIIQGFLGSDTVRIGNLVSPEQSFGLSLEEYGFDSLPFDGILGLAFPAMGIEDTIPIFDNLWSHGAFSEPVFAFYLNTNKPEGSVVMFGGVDHRYYKGELNWIPVSQTSHWQISMNNISMNGTVTACSCGCEALLDTGTSMIYGP
Anwendungsbeschreibung: Biological Origin: Bos taurus (Bovine). Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) PAG2.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Bos taurus (Bovine) PAG2.