Human Novel Coronavirus Spike glycoprotein(S) protein
Artikelnummer:
BYT-ORB668864
- Bilder (3)
| Artikelname: | Human Novel Coronavirus Spike glycoprotein(S) protein |
| Artikelnummer: | BYT-ORB668864 |
| Hersteller Artikelnummer: | orb668864 |
| Alternativnummer: | BYT-ORB668864-1,BYT-ORB668864-100,BYT-ORB668864-20 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | / |
| This Human Novel Coronavirus Spike glycoprotein(S) protein spans the amino acid sequence from region 319-541aa (V483A). Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 27.8 kDa |
| UniProt: | P0DTC2 |
| Puffer: | Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Quelle: | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Lyophilized powder |
| Sequenz: | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Anwendungsbeschreibung: | Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 5 µg/ml can bind human ACE2, the EC50 is 196.4-272.1 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 2 µg/ml can bind SARS-CoV-2-S Antibody, the EC50 is 7.481- 18.76 ng/ml. Application Notes: SARS-CoV-2 Related Proteins |



