Human FOLH1 protein

Artikelnummer: BYT-ORB704604
Artikelname: Human FOLH1 protein
Artikelnummer: BYT-ORB704604
Hersteller Artikelnummer: orb704604
Alternativnummer: BYT-ORB704604-20,BYT-ORB704604-100,BYT-ORB704604-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cell growth-inhibiting gene 27 proteinFolate hydrolase 1Folylpoly-gamma-glutamate carboxypeptidase ,FGCPGlutamate carboxypeptidase II ,GCPIIMembrane glutamate carboxypeptidase ,mGCPN-acetylated-alpha-linked acidic dipeptidase I ,NAALADase IProstate-specific membrane antigen ,PSM ,PSMAPteroylpoly-gamma-glutamate carboxypeptidase
This Human FOLH1 protein spans the amino acid sequence from region 48-750aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 83.1 kDa
UniProt: Q04609
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FOLH1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FOLH1.