Human TNFRSF13C protein

Artikelnummer: BYT-ORB705223
Artikelname: Human TNFRSF13C protein
Artikelnummer: BYT-ORB705223
Hersteller Artikelnummer: orb705223
Alternativnummer: BYT-ORB705223-20,BYT-ORB705223-100,BYT-ORB705223-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This Human TNFRSF13C protein spans the amino acid sequence from region 7-71aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 36.4 kDa
UniProt: Q96RJ3
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 µg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 µg/ml can bind Biotinylated human TNFSF13B, the EC50 is 0.2699-0.5613 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 µg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml.
Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 µg/ml can bind Biotinylated human TNFSF13B, the EC50 is 0.2699-0.5613 ng/ml.