Human BZW2 protein

Artikelnummer: BYT-ORB705314
Artikelname: Human BZW2 protein
Artikelnummer: BYT-ORB705314
Hersteller Artikelnummer: orb705314
Alternativnummer: BYT-ORB705314-20,BYT-ORB705314-100,BYT-ORB705314-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This Human BZW2 protein spans the amino acid sequence from region 1-419aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 75.2 kDa
UniProt: Q9Y6E2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 µg/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22 µg/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized OMA1 at 5 µg/ml can bind human BZW2, the EC50 of human BZM2 is 45.42-72.22 µg/ml.