Warenkorb

Produktsuche

Home
Produkte
Polyclonal Rabbit anti-Human MKI67 / Ki67 Antibody (IF, WB) LS-C331889

Polyclonal Rabbit anti-Human MKI67 / Ki67 Antibody (IF, WB) LS-C331889

Artikelnummer: LS-C331889-100

Bilder (2)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human MKI67 / Ki67 Antibody (IF, WB) LS-C331889
Artikelnummer:	LS-C331889-100
Hersteller Artikelnummer:	LS-C331889-100
Alternativnummer:	LS-C331889-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IF, WB
Spezies Reaktivität:	Human
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1200-1300 of human MKI67 (NP_001139438.1). QKLDLTENLTGSKRRLQTPKEKAQALEDLAGFKELFQTRGHTEESMTNDKTAKVACKSSQPDPDKNPASSKRRLKTSLGKVGVKEELLAVGKLTQTSGETT
Konjugation:	Unconjugated
Alternative Synonym:	MKI67, Antigen KI-67, Ki67, KIA

Ki67 antibody LS-C331889 is an unconjugated rabbit polyclonal antibody to human Ki67 (MKI67). Validated for IF and WB.

Klonalität:	Polyclonal
NCBI:	4288
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IF (1:50 - 1:100), WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 319kDa/358kDa, while the observed MW by Western blot was 360kDa.

	Western blot analysis of extracts of HeLa cells.
	Immunofluorescence analysis.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten