Polyclonal Rabbit anti-Human IL8 / Interleukin 8 Antibody (IHC, WB) LS-C332151

Artikelnummer: LS-C332151-100
Artikelname: Polyclonal Rabbit anti-Human IL8 / Interleukin 8 Antibody (IHC, WB) LS-C332151
Artikelnummer: LS-C332151-100
Hersteller Artikelnummer: LS-C332151-100
Alternativnummer: LS-C332151-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-99 of human IL8 (NP_000575.1). EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Konjugation: Unconjugated
Alternative Synonym: CXCL8, 3-10C, AMCF-I, B-ENAP, C-X-C motif chemokine 8, GCP-1, IL-8, IL8, Interleukin-8, K60, LECT, GCP1, LUCT, NAF, NAP1, Neutrophil-activating factor, Interleukin 8, Protein 3-10C, MDNCF, TSG-1, Emoctakin, LYNAP, MONAP, NAP-1, SCYB8, T-cell chemotactic
Interleukin 8 antibody LS-C332151 is an unconjugated rabbit polyclonal antibody to human Interleukin 8 (IL8). Validated for IHC and WB.
Klonalität: Polyclonal
NCBI: 3576
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 11kDa, while the observed MW by Western blot was 11kDa.
Western blot analysis of extracts of A431 cells.
Immunohistochemistry of paraffin-embedded mouse lung tissue.