Polyclonal Rabbit anti-Human ATG4A Antibody (IHC, WB) LS-C332196

Artikelnummer: LS-C332196-100
Artikelname: Polyclonal Rabbit anti-Human ATG4A Antibody (IHC, WB) LS-C332196
Artikelnummer: LS-C332196-100
Hersteller Artikelnummer: LS-C332196-100
Alternativnummer: LS-C332196-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 289-398 of human ATG4A (NP_443168.2). TEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Konjugation: Unconjugated
Alternative Synonym: ATG4A, AUTL2, Autophagin-2, APG4A, Autophagin 2, Cysteine protease ATG4A, HAPG4A, APG4 autophagy 4 homolog A
ATG4A antibody LS-C332196 is an unconjugated rabbit polyclonal antibody to ATG4A from human. It is reactive with human and mouse. Validated for IHC, IP and WB.
Klonalität: Polyclonal
NCBI: 115201
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IHC (1:50 - 1:200), IP (1:20 - 1:100), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 36kDa/38kDa/42kDa/45kDa, while the observed MW by Western blot was 46kDa.
Western blot analysis of extracts of various cell lines.
Immunoprecipitation analysis of extracts of K562 cells.