Polyclonal Rabbit anti-Human IGF2BP2 Antibody (IHC, WB) LS-C332239

Artikelnummer: LS-C332239-20

Bilder (2)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human IGF2BP2 Antibody (IHC, WB) LS-C332239
Artikelnummer:	LS-C332239-20
Hersteller Artikelnummer:	LS-C332239-20
Alternativnummer:	LS-C332239-20
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, WB
Spezies Reaktivität:	Human, Mouse
Immunogen:	A synthetic peptide corresponding to a sequence within amino acids 500 to the C-Terminus of human IGF2BP2 (NP_006539.3). NFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK
Konjugation:	Unconjugated
Alternative Synonym:	IGF2BP2, IMP2, IGF2 mRNA-binding protein 2, p62, VICKZ2, IGF-II mRNA-binding protein 2, IMP-2, VICKZ family member 2

IGF2BP2 antibody LS-C332239 is an unconjugated rabbit polyclonal antibody to IGF2BP2 from human. It is reactive with human and mouse. Validated for IHC and WB.

Klonalität:	Polyclonal
NCBI:	10644
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IHC (1:50 - 1:100), WB (1:200 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 54kDa/58kDa/59kDa/61kDa/66kDa, while the observed MW by Western blot was 66kDa.

	Western blot analysis of extracts of Jurkat cells.
	Immunohistochemistry of paraffin-embedded mouse liver tissue.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten