Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of human NPY (NP_000896.1). MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Konjugation:
Unconjugated
Alternative Synonym:
NPY, Pro-neuropeptide Y, Neuropeptide Y, PYY4
NPY antibody LS-C332403 is an unconjugated rabbit polyclonal antibody to NPY (Neuropeptide Y) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.