Polyclonal Rabbit anti-Human H1F0 Antibody (IHC, WB) LS-C332470

Artikelnummer: LS-C332470-100

Bilder (2)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human H1F0 Antibody (IHC, WB) LS-C332470
Artikelnummer:	LS-C332470-100
Hersteller Artikelnummer:	LS-C332470-100
Alternativnummer:	LS-C332470-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IHC, WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human H1F0 (NP_005309.1). MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSV
Konjugation:	Unconjugated
Alternative Synonym:	H1F0, H1 histone family, member 0, Histone H1(0), H1.0, H1(0), H1-0, H10, H1FV, Histone H1, Histone H1.0

H1F0 antibody LS-C332470 is an unconjugated rabbit polyclonal antibody to H1F0 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Klonalität:	Polyclonal
NCBI:	3005
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 19kDa/20kDa, while the observed MW by Western blot was 30kDa.

	Western blot analysis of extracts of various cell lines.
	Immunohistochemistry of paraffin-embedded mouse brain tissue.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten